RAB33B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096779
Article Name: RAB33B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096779
Supplier Catalog Number: orb2096779
Alternative Catalog Number: BYT-ORB2096779-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen for Anti-RAB33B antibody is: synthetic peptide directed towards the C-terminal region of Human RB33B
Conjugation: Biotin
Alternative Names: SMC2
RAB33B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25 kDa
NCBI: 112586
UniProt: Q9H082
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VGNKCDLRSAIQVPTDLAQKFADTHSMPLFETSAKNPNDNDHVEAIFMTL