ACSBG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096875
Article Name: ACSBG1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096875
Supplier Catalog Number: orb2096875
Alternative Catalog Number: BYT-ORB2096875-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACSBG1
Conjugation: Biotin
Alternative Names: BG, BG1, BGM, LPD, GR-LACS
ACSBG1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 79kDa
NCBI: 055977
UniProt: Q96GR2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DPSMLDSRETPQESRQDMIVRTTQEKLKTSSLTDRQPLSKESLNHALELS