TARP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096911
Article Name: TARP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096911
Supplier Catalog Number: orb2096911
Alternative Catalog Number: BYT-ORB2096911-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TARP
Conjugation: Biotin
Alternative Names: CD3G, TCRG, TCRGV, TCRGC1, TCRGC2
TARP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 13kDa
NCBI: 001003806
UniProt: Q0VGM3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YMKFSWLTVPEKSLDKEHRCIVRHENNKNGVDQEIIFPPIKTDVITMDPK