SPANXB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096917
Article Name: SPANXB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096917
Supplier Catalog Number: orb2096917
Alternative Catalog Number: BYT-ORB2096917-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human SPANXB1
Conjugation: Biotin
Alternative Names: B1, CT11.2, SPANXB, SPANX-B, SPANXB2, SPANXF1, SPANXF2
SPANXB1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 115850
UniProt: Q9NS25
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MPETPTGDSDPQPAPKKMKTSESSTILVVRYRRNVKRTSPEELVNDHARE