FAM120C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096935
Article Name: FAM120C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096935
Supplier Catalog Number: orb2096935
Alternative Catalog Number: BYT-ORB2096935-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human FAM120C
Conjugation: Biotin
Alternative Names: ORF34, CXorf17
FAM120C Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 120kDa
NCBI: 060318
UniProt: Q9NX05
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IKAVSEYVSSIKDPSNLDVVGKDVFKQSQSRTEDKIERFKKAVEYYSVTT