CTAG1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2096938
Article Name: CTAG1B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2096938
Supplier Catalog Number: orb2096938
Alternative Catalog Number: BYT-ORB2096938-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human CTAG1B
Conjugation: Biotin
Alternative Names: CTAG, ESO1, CT6.1, CTAG1, LAGE-2, LAGE2B, NY-ESO-1
CTAG1B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 18kDa
NCBI: 001318
UniProt: P78358
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NILTIRLTAADHRQLQLSISSCLQQLSLLMWITQCFLPVFLAQPPSGQRR