RAB34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2097178
Article Name: RAB34 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2097178
Supplier Catalog Number: orb2097178
Alternative Catalog Number: BYT-ORB2097178-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAB34
Conjugation: Biotin
Alternative Names: RAH, NARR, RAB39
RAB34 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 29kDa
NCBI: 114140
UniProt: Q9BZG1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FFFRVAALTFEANVLAELEKSGARRIGDVVRINSDDSNLYLTASKKKPTC