IMMP2L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2097205
Article Name: IMMP2L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2097205
Supplier Catalog Number: orb2097205
Alternative Catalog Number: BYT-ORB2097205-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human IMMP2L
Conjugation: Biotin
Alternative Names: IMP2, IMP2-LIKE, IMMP2L-IT1
IMMP2L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 20kDa
NCBI: 115938
UniProt: Q96T52
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LNPGGSQSSDVVLLNHWKVRNFEVHRGDIVSLVSPKNPEQKIIKRVIALE