RAB6C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2097292
| Article Name: |
RAB6C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2097292 |
| Supplier Catalog Number: |
orb2097292 |
| Alternative Catalog Number: |
BYT-ORB2097292-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human RAB6C |
| Conjugation: |
Biotin |
| Alternative Names: |
WTH3 |
| RAB6C Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
28kDa |
| NCBI: |
115520 |
| UniProt: |
Q9H0N0 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: DVIITLVGNRTDLADKRQVSVEEGERKAKGLNVTFIETRAKAGYNVKQLF |
