ABLM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2098246
| Article Name: |
ABLM1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2098246 |
| Supplier Catalog Number: |
orb2098246 |
| Alternative Catalog Number: |
BYT-ORB2098246-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human ABLM1 |
| Conjugation: |
Biotin |
| Alternative Names: |
ABLIM, LIMAB1, LIMATIN, abLIM-1 |
| ABLM1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
78 kDa |
| NCBI: |
001003407 |
| UniProt: |
O14639 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: TPKIETDHWPGPPSFAVVGPDMKRRSSGREEDDEELLRRRQLQEEQLMKL |
