DGKG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2098261
Article Name: DGKG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2098261
Supplier Catalog Number: orb2098261
Alternative Catalog Number: BYT-ORB2098261-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human DGKG
Conjugation: Biotin
Alternative Names: DAGK3, DGK-GAMMA
DGKG Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 82 kDa
UniProt: P49619
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KLLPMQVDGEPWMQPCCTIKITHKNQAPMMMGPPQKSSFFSLRRKSRSKD