OR1C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2098396
Article Name: OR1C1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2098396
Supplier Catalog Number: orb2098396
Alternative Catalog Number: BYT-ORB2098396-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of mouse OR1C1
Conjugation: Biotin
Alternative Names: OR1-42, ORL211, TPCR27, HSTPCR27, OR1.5.10
OR1C1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 036485
UniProt: Q15619
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SVIYVYFRPLSMYSVVKDRIATVMYTVVTPMMNPFIYSLRNKDMKRGLRK