RASSF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2098408
Article Name: RASSF1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2098408
Supplier Catalog Number: orb2098408
Alternative Catalog Number: BYT-ORB2098408-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RASSF1
Conjugation: Biotin
Alternative Names: 123F2, RDA32, NORE2A, RASSF1A, REH3P21
RASSF1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 733831
UniProt: Q9NS23
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LAGPSDKALSFVLKENDSGEVNWDAFSMPELHNFLRILQREEEEHLRQIL