RAB8B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2098411
Article Name: RAB8B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2098411
Supplier Catalog Number: orb2098411
Alternative Catalog Number: BYT-ORB2098411-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human RAB8B
Conjugation: Biotin
Alternative Names: FLJ38125
RAB8B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 057614
UniProt: Q92930
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SAKSSANVEEAFFTLARDIMTKLNRKMNDSNSAGAGGPVKITENRSKKTS