LGR5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2098450
Article Name: LGR5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2098450
Supplier Catalog Number: orb2098450
Alternative Catalog Number: BYT-ORB2098450-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC
Immunogen: The immunogen is a synthetic peptide directed towards the following sequence KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
Conjugation: Biotin
Alternative Names: FEX, HG38, GPR49, GPR67, GRP49
LGR5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 100 kDa
NCBI: 003658
UniProt: O75473
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG