MANF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2098486
Article Name: MANF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2098486
Supplier Catalog Number: orb2098486
Alternative Catalog Number: BYT-ORB2098486-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MANF
Conjugation: Biotin
Alternative Names: ARP, ARMET
MANF Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 21kDa
NCBI: 006001
UniProt: A8K878
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EKICEKLKKKDSQICELKYDKQIDLSTVDLKKLRVKELKKILDDWGETCK