SERPINA1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2099007
| Article Name: |
SERPINA1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2099007 |
| Supplier Catalog Number: |
orb2099007 |
| Alternative Catalog Number: |
BYT-ORB2099007-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C terminal region of human SERPINA1 |
| Conjugation: |
FITC |
| Alternative Names: |
PI, A1A, AAT, PI1, A1AT, nNIF, PRO2275, alpha1AT |
| SERPINA1 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
44kDa |
| NCBI: |
001121178 |
| UniProt: |
P01009 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: LTHDIITKFLENEDRRSASLHLPKLSITGTYDLKSVLGQLGITKVFSNGA |
