SERPINA10 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099009
Article Name: SERPINA10 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099009
Supplier Catalog Number: orb2099009
Alternative Catalog Number: BYT-ORB2099009-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINA10
Conjugation: HRP
Alternative Names: PZI, ZPI
SERPINA10 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 057270
UniProt: Q9UK55
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRE