SERPINA10 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099010
Article Name: SERPINA10 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099010
Supplier Catalog Number: orb2099010
Alternative Catalog Number: BYT-ORB2099010-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SERPINA10
Conjugation: FITC
Alternative Names: PZI, ZPI
SERPINA10 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 057270
UniProt: Q9UK55
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SPFGMSLAMTGLMLGATGPTETQIKRGLHLQALKPTKPGLLPSLFKGLRE