SPINT1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099031
Article Name: SPINT1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099031
Supplier Catalog Number: orb2099031
Alternative Catalog Number: BYT-ORB2099031-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPINT1
Conjugation: FITC
Alternative Names: HAI, HAI1, MANSC2
SPINT1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 857593
UniProt: O43278
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YGGCYGNKNNFEEEQQCLESCRGISKKDVFGLRREIPIPSTGSVEMAVAV