SLPI Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099043
Article Name: SLPI Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099043
Supplier Catalog Number: orb2099043
Alternative Catalog Number: BYT-ORB2099043-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SLPI
Conjugation: FITC
Alternative Names: ALP, MPI, ALK1, BLPI, HUSI, WAP4, WFDC4, HUSI-I
SLPI Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 003055
UniProt: P03973
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VLLALGTLAPWAVEGSGKSFKAGVCPPKKSAQCLRYKKPECQSDWQCPGK