RWDD1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099046
Article Name: RWDD1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099046
Supplier Catalog Number: orb2099046
Alternative Catalog Number: BYT-ORB2099046-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RWDD1
Conjugation: FITC
Alternative Names: CGI-24, PTD013
RWDD1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 001007465
UniProt: Q9H446
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EKQLFHGTPVTIENFLNWKAKFDAELLEIKKKRMKEEEQAGKNKLSGKQL