ITIH1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099054
Article Name: ITIH1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099054
Supplier Catalog Number: orb2099054
Alternative Catalog Number: BYT-ORB2099054-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ITIH1
Conjugation: HRP
Alternative Names: H1P, ITIH, SHAP, IATIH, IGHEP1, ITI-HC1
ITIH1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 86kDa
NCBI: 001159906
UniProt: B7Z558
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VSDIHPGSDPTKPDATMVVRNRRLTVTRGLQKDYSKDPWHGAEVSCWFIH