TIMP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099075
Article Name: TIMP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099075
Supplier Catalog Number: orb2099075
Alternative Catalog Number: BYT-ORB2099075-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TIMP3
Conjugation: HRP
Alternative Names: SFD, K222, K222TA2, HSMRK222
TIMP3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 000353
UniProt: P35625
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MTPWLGLIVLLGSWSLGDWGAEACTCSPSHPQDAFCNSDIVIRAKVVGKK