TIMP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099081
Article Name: TIMP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099081
Supplier Catalog Number: orb2099081
Alternative Catalog Number: BYT-ORB2099081-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TIMP2
Conjugation: HRP
Alternative Names: DDC8, CSC-21K
TIMP2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 003246
UniProt: P16035
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: IVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVT