TIMP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099088
Article Name: TIMP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099088
Supplier Catalog Number: orb2099088
Alternative Catalog Number: BYT-ORB2099088-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human TIMP1
Conjugation: FITC
Alternative Names: EPA, EPO, HCI, CLGI, TIMP, TIMP-1
TIMP1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 003245
UniProt: Q6FGX5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QRYEIKMTKMYKGFQALGDAADIRFVYTPAMESVCGYFHRSHNRSEEFLI