CSTB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099091
Article Name: CSTB Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099091
Supplier Catalog Number: orb2099091
Alternative Catalog Number: BYT-ORB2099091-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human CSTB
Conjugation: FITC
Alternative Names: PME, ULD, CST6, EPM1, STFB, CPI-B, EPM1A
CSTB Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 11kDa
NCBI: 000091
UniProt: P04080
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRV