SERPINB9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099094
Article Name: SERPINB9 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099094
Supplier Catalog Number: orb2099094
Alternative Catalog Number: BYT-ORB2099094-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human SPB9
Conjugation: FITC
Alternative Names: PI9, CAP3, PI-9, CAP-3
SERPINB9 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 41 kDa
NCBI: 004146
UniProt: P50453
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LTAWTKPDCMKSTEVEVLLPKFKLQEDYDMESVLRHLGIVDAFQQGKADL