AMBP Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099114
Article Name: AMBP Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099114
Supplier Catalog Number: orb2099114
Alternative Catalog Number: BYT-ORB2099114-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human AMBP
Conjugation: HRP
Alternative Names: A1M, HCP, ITI, UTI, EDC1, HI30, ITIL, IATIL, ITILC
AMBP Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 001624
UniProt: P02760
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: VCEETSGAYEKTDTDGKFLYHKSKWNITMESYVVHTNYDEYAIFLTKKFS