Ambp Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2099118
Article Name: Ambp Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099118
Supplier Catalog Number: orb2099118
Alternative Catalog Number: BYT-ORB2099118-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Ambp
Conjugation: FITC
Alternative Names: UTI
Ambp Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 38kDa
NCBI: 037033
UniProt: Q64240
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ELWAFDAAQGKCIQFIYGGCKGNGNKFYSEKECKEYCGVPGDGYEELTRS