RORC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2099131
Article Name: RORC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099131
Supplier Catalog Number: orb2099131
Alternative Catalog Number: BYT-ORB2099131-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORC
Conjugation: Biotin
Alternative Names: TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA
RORC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 001001523
UniProt: P51449
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KICGDKSSGIHYGVITCEGCKGFFRRSQRCNAAYSCTRQQNCPIDRTSRN