RORG Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099132
Article Name: RORG Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099132
Supplier Catalog Number: orb2099132
Alternative Catalog Number: BYT-ORB2099132-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORG
Conjugation: HRP
Alternative Names: TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA
RORG Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 56 kDa
NCBI: 001001523
UniProt: P51449
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: DSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLG