RORG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2099134
Article Name: RORG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099134
Supplier Catalog Number: orb2099134
Alternative Catalog Number: BYT-ORB2099134-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RORG
Conjugation: Biotin
Alternative Names: TOR, RORG, RZRG, IMD42, NR1F3, RZR-GAMMA
RORG Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 56 kDa
NCBI: 001001523
UniProt: P51449
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DSLHAEVQKQLQQRQQQQQEPVVKTPPAGAQGADTLTYTLGLPDGQLPLG