SPATA2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099135
Article Name: SPATA2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099135
Supplier Catalog Number: orb2099135
Alternative Catalog Number: BYT-ORB2099135-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human SPATA2
Conjugation: HRP
Alternative Names: PD1, tamo, PPP1R145
SPATA2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 42kDa
NCBI: 001129245
UniProt: Q9UM82
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SRVALQKSASERAAKDYYKPRVTKPSRSVDAYDSYWESRKPPLKASLSLR