GPR83 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2099167
Article Name: GPR83 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099167
Supplier Catalog Number: orb2099167
Alternative Catalog Number: BYT-ORB2099167-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human GPR83
Conjugation: Biotin
Alternative Names: GIR, GPR72
GPR83 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 48kDa
NCBI: 057624
UniProt: Q9NYM4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QEDRPPSPVPSFRVAWTEKNDGQRAPLANNLLPTSQLQSGKTDLSSVEPI