IZUMO1R Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099168
Article Name: IZUMO1R Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099168
Supplier Catalog Number: orb2099168
Alternative Catalog Number: BYT-ORB2099168-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FOLR4
Conjugation: HRP
Alternative Names: JUNO, FOLR4, Folbp3, FR-delta
IZUMO1R Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 28kDa
NCBI: 001073955
UniProt: C9JJV3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TCKSNWRGGWDWSQGKNRCPKGAQCLPFSHYFPTPADLCEKTWSNSFKAS