CD8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2099176
Article Name: CD8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099176
Supplier Catalog Number: orb2099176
Alternative Catalog Number: BYT-ORB2099176-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD8A
Conjugation: Biotin
Alternative Names: CD8, p32, Leu2
CD8A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 001139345
UniProt: P01732
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTT