CD7 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099180
Article Name: CD7 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099180
Supplier Catalog Number: orb2099180
Alternative Catalog Number: BYT-ORB2099180-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CD7
Conjugation: HRP
Alternative Names: GP40, TP41, Tp40, LEU-9
CD7 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 006128
UniProt: P09564
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SGGLRGIYLRQLGPQPQDIIYYEDGVVPTTDRRFRGRIDFSGSQDNLTIT