NRP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2099195
Article Name: NRP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2099195
Supplier Catalog Number: orb2099195
Alternative Catalog Number: BYT-ORB2099195-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NRP1
Conjugation: HRP
Alternative Names: NP1, NRP, BDCA4, CD304, VEGF165R
NRP1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 72kDa
NCBI: 001019799
UniProt: O14786
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: FNPHFDLEDRDCKYDYVEVFDGENENGHFRGKFCGKIAPPPVVSSGPFLF