PDS5B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2100235
Article Name: PDS5B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2100235
Supplier Catalog Number: orb2100235
Alternative Catalog Number: BYT-ORB2100235-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDS5B
Conjugation: Biotin
Alternative Names: AS3, APRIN, CG008
PDS5B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 159kDa
NCBI: 055847
UniProt: Q9NTI5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DEQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMK