H2AFY Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2100265
Article Name: H2AFY Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2100265
Supplier Catalog Number: orb2100265
Alternative Catalog Number: BYT-ORB2100265-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human H2AFY
Conjugation: Biotin
Alternative Names: H2A.y, H2A/y, H2AFY, mH2A1, H2AF12M, MACROH2A1.1, macroH2A1.2
H2AFY Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 001035248
UniProt: O75367
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PVSKKAGGKKGARKSKKQGEVSKAASADSTTEGTPADGFTVLSTKSLFLG