ZNF442 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2100385
Article Name: ZNF442 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2100385
Supplier Catalog Number: orb2100385
Alternative Catalog Number: BYT-ORB2100385-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF442
Conjugation: Biotin
Alternative Names: FLJ14356
ZNF442 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 73kDa
NCBI: 110451
UniProt: Q9H7R0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YLRHERTHTGEKPYECKHCSKAFPDYSSYVRHERTHTGEKPYKCKRCGRA