TFEB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2100499
Article Name: TFEB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2100499
Supplier Catalog Number: orb2100499
Alternative Catalog Number: BYT-ORB2100499-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TFEB
Conjugation: Biotin
Alternative Names: TCFEB, BHLHE35, ALPHATFEB
TFEB Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 53kDa
NCBI: 009093
UniProt: P19484
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DFSHSLSFGGREDEGPPGYPEPLAPGHGSPFPSLSKKDLDLMLLDDSLLP