CHTF18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2101408
Article Name: CHTF18 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101408
Supplier Catalog Number: orb2101408
Alternative Catalog Number: BYT-ORB2101408-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CHTF18
Conjugation: Biotin
Alternative Names: CHL12, Ctf18, RUVBL, C16orf41, C321D2.2, C321D2.3, C321D2.4
CHTF18 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 107kDa
NCBI: 071375
UniProt: Q8WVB6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR