FBXW4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2101429
Article Name: FBXW4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101429
Supplier Catalog Number: orb2101429
Alternative Catalog Number: BYT-ORB2101429-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human FBXW4
Conjugation: Biotin
Alternative Names: DAC, FBW4, FBWD4, SHFM3, SHSF3
FBXW4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 071322
UniProt: P57775
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RQMPWMQLEDDSLYISQANFILAYQFRPDGASLNRRPLGVFAGHDEDVCH