Nap1l2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2101435
Article Name: Nap1l2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101435
Supplier Catalog Number: orb2101435
Alternative Catalog Number: BYT-ORB2101435-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Nap1l2
Conjugation: Biotin
Alternative Names: Bp, Bpx
Nap1l2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 032697
UniProt: P51860
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QTRAAHLESKFLREFHDIERKFAEMYQPLLEKRRQIINAVYEPTEEECEY