RIC8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2101441
Article Name: RIC8A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101441
Supplier Catalog Number: orb2101441
Alternative Catalog Number: BYT-ORB2101441-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RIC8A
Conjugation: Biotin
Alternative Names: RIC8
RIC8A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 068751
UniProt: Q9NPQ8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KLTERVGLYRERSFPHDVQFFDLRLLFLLTALRTDVRQQLFQELKGVRLL