GNB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2101471
Article Name: GNB4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101471
Supplier Catalog Number: orb2101471
Alternative Catalog Number: BYT-ORB2101471-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GNB4
Conjugation: Biotin
Alternative Names: CMTD1F
GNB4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 067642
UniProt: Q9HAV0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DGMCRQSFTGHVSDINAVSFFPNGYAFATGSDDATCRLFDLRADQELLLY