PRUNE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2101483
Article Name: PRUNE1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101483
Supplier Catalog Number: orb2101483
Alternative Catalog Number: BYT-ORB2101483-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human PRUNE
Conjugation: Biotin
Alternative Names: PRUNE, DRES17, HTCD37, NMIHBA, DRES-17, H-PRUNE
PRUNE1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 26kDa
NCBI: 001290158
UniProt: Q86TP1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NSLISGLSQDEEDPPLPPTPMNSLVDECPLDQGLPKLSAEAVFEKCSQIS