Ift80 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2101612
Article Name: Ift80 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101612
Supplier Catalog Number: orb2101612
Alternative Catalog Number: BYT-ORB2101612-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: Biotin
Alternative Names: Wdr5, Wdr56, mKIAA1374, 4921524P20Rik
Ift80 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 85kDa
NCBI: 080917
UniProt: Q8K057
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PNTIYVDRDILPKTLYERDASEYSKNPHIVSFVGNQVTIRRADGSLVHIS